PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00042195-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MIKC_MADS
Protein Properties Length: 155aa    MW: 18026.8 Da    PI: 10.1595
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00042195-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.1e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien + rqvtf+kRrng+lKKA+ELSvLCdaev +++fs++gklye++s
  PSME_00042195-RA  9 KRIENATSRQVTFTKRRNGLLKKAYELSVLCDAEVGLMVFSPRGKLYEFAS 59
                      79***********************************************86 PP

2K-box75.11.9e-2570151284
             K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                       q s+++   e+++e l++e++ ++++i +L+++qR++ Ge+L ++slkeL+qLe q+e++l++iR++Kne+l++q+e+l++k 
  PSME_00042195-RA  70 Q-STNNTIIEQDNEGLNREFKHMEDRITSLESTQRKMSGEGLVTCSLKELNQLEIQVERGLRHIRARKNEILMDQVEQLKRKV 151
                       3.45555889999********************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.679161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-33375IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-31323IPR002100Transcription factor, MADS-box
CDDcd002658.07E-43374No hitNo description
PfamPF003192.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-2079151IPR002487Transcription factor, K-box
PROSITE profilePS5129712.24181155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MVRGKTQIKR IENATSRQVT FTKRRNGLLK KAYELSVLCD AEVGLMVFSP RGKLYEFASA  60
SMQKILERYQ STNNTIIEQD NEGLNREFKH MEDRITSLES TQRKMSGEGL VTCSLKELNQ  120
LEIQVERGLR HIRARKNEIL MDQVEQLKRK VCNSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-21373272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-21373272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-21373272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-21373272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-21373272Myocyte-specific enhancer factor 2A
3kov_B1e-21373272Myocyte-specific enhancer factor 2A
3kov_I1e-21373272Myocyte-specific enhancer factor 2A
3kov_J1e-21373272Myocyte-specific enhancer factor 2A
3p57_A1e-21373272Myocyte-specific enhancer factor 2A
3p57_B1e-21373272Myocyte-specific enhancer factor 2A
3p57_C1e-21373272Myocyte-specific enhancer factor 2A
3p57_D1e-21373272Myocyte-specific enhancer factor 2A
3p57_I1e-21373272Myocyte-specific enhancer factor 2A
3p57_J1e-21373272Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490257.14e-59PREDICTED: MADS-box protein SOC1-like
SwissprotO646453e-58SOC1_ARATH; MADS-box protein SOC1
TrEMBLA9P2G78e-79A9P2G7_PICSI; Putative uncharacterized protein
STRINGGLYMA18G45780.13e-58(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-59AGAMOUS-like 20